Also known as Gattex Kit, ALX-0600, Teduglutide [rDNA origin], HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, ALX 0600, (Gly2)glp-2, His-gly-asp-gly-ser-phe-ser-asp-glu-met-asn-thr-ile-leu-asp-asn-leu-ala-ala-arg-asp-phe-ile-asn-trp-leu-ile-gln-thr-lys-ile-thr-asp, Teduglutide Recombinant
Teduglutide, sold under the brand names Revestive (EU) and Gattex (US), is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion. It was approved in both the European Union and the United States in 2012.
~2 min read
Teduglutide, sold under the brand names Revestive (EU) and Gattex (US), is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion. It was approved in both the European Union and the United States in 2012.
Teduglutide is available as a generic medication.
via Wikipedia infobox
via PubMed
via Wikidata sitelinks · CC0
Discovered by embedding cosine similarity (sentence-transformers MiniLM, 384-dim).